NSDHL antibody

Catalog No. ABIN630356

The Rabbit Polyclonal anti-NSDHL antibody is suitable to detect NSDHL in samples from Human, Rat and Mouse. It has been validated for WB.

Quick Overview for NSDHL antibody (ABIN630356)

Target: NSDHL (NAD(P) Dependent Steroid Dehydrogenase-Like (NSDHL))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NSDHL antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NSDHL Antibody

Purification: Purified

Immunogen: NSDHL antibody was raised using a synthetic peptide corresponding to a region with amino acids RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGN

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NSDHL Blocking Peptide, (ABIN5615064), is also available for use as a blocking control in assays to test for specificity of this NSDHL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSDHL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NSDHL

Target: NSDHL (NAD(P) Dependent Steroid Dehydrogenase-Like (NSDHL))

Alternative Name: NSDHL

Background: NSDHL is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in NSDHL gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males.

Molecular Weight: 42 kDa (MW of target protein)