Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Solute Carrier Family 16 (Monocarboxylic Acid Transporters), Member 8 (SLC16A8) antibody

Antigen

Solute Carrier Family 16 (Monocarboxylic Acid Transporters), Member 8 (SLC16A8)

Synonyms fb78b01, zgc:56344, wu:fb78b01, wu:fk28b01
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Immunohistochemistry (IHC), Western Blotting (WB)
Catalog no. ABIN630366
Quantity 100 ug  (1 mg/ml)
Price 410.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name SLC16A8
Immunogen SLC16A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI
Description SLC16A8 is proton-linked monocarboxylate transporter. It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.
Molecular Weight 55 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Total IgG Protein A purified
Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC16A8 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Cancer, Metabolism
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Solute Carrier Family 16 (Monocarboxylic Acid Transporters), Member 8 (SLC16A8)", type "Antibodies"
Hosts Rabbit (6)
Reactivities Human (6)
Applications Western Blotting (WB) (6), Immunohistochemistry (IHC) (1)