SLCO6A1 antibody (C-Term)

Catalog No. ABIN630373

This Rabbit Polyclonal antibody specifically detects SLCO6A1 in WB. It exhibits reactivity toward Human.

Quick Overview for SLCO6A1 antibody (C-Term) (ABIN630373)

Target: SLCO6A1 (Solute Carrier Organic Anion Transporter Family, Member 6A1 (SLCO6A1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLCO6A1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLCO6A1 Antibody

Binding Specificity: C-Term

Specificity: SLCO6 A1 antibody was raised against the C terminal of SLCO6 1

Purification: Purified

Immunogen: SLCO6 A1 antibody was raised using the C terminal of SLCO6 1 corresponding to a region with amino acids LAMTRVVPDKLRSLALGVSYVILRIFGTIPGPSIFKMSGETSCILRDVNK

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLCO6A1 Blocking Peptide, (ABIN940171), is also available for use as a blocking control in assays to test for specificity of this SLCO6A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLCO6A1

Target: SLCO6A1 (Solute Carrier Organic Anion Transporter Family, Member 6A1 (SLCO6A1))

Alternative Name: SLCO6A1

Background: SLCO6A1 is involved in transporter activity (solute carrier).

Molecular Weight: 79 kDa (MW of target protein)