SLC36A3 antibody

Catalog No. ABIN630374

The Rabbit Polyclonal anti-SLC36A3 antibody is suitable to detect SLC36A3 in samples from Human. It has been validated for IHC and WB.

Quick Overview for SLC36A3 antibody (ABIN630374)

Target: SLC36A3 (Solute Carrier Family 36 (Proton/amino Acid Symporter), Member 3 (SLC36A3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC36A3 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Product Details anti-SLC36A3 Antibody

Purification: Purified

Immunogen: SLC36 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLLGRDYNSELNSLDNGPQSPSESSSSITSENVHPAGEAGLSMMQTLIH

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC36A3 Blocking Peptide, (ABIN5616243), is also available for use as a blocking control in assays to test for specificity of this SLC36A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC36A3

Target: SLC36A3 (Solute Carrier Family 36 (Proton/amino Acid Symporter), Member 3 (SLC36A3))

Alternative Name: SLC36A3

Background: The function of SLC36A3 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 52 kDa (MW of target protein)