Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

N-Acetyltransferase 2 (Arylamine N-Acetyltransferase) (NAT2) antibody

Antigen

N-Acetyltransferase 2 (Arylamine N-Acetyltransferase) (NAT2)

Synonyms AAC2, PNAT, NAT-2
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN630377
Quantity 100 ug  (1 mg/ml)  (Variants)
Price 410.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name NAT2
Immunogen NAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIE
Description NAT2 is a N-acetyltransferase 2 (arylamine N-acetyltransferase 2). This enzyme functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in its gene are reponsible for the N-acetylation polymorphism in which human populations segregate into rapid,intermediate, and slow acetylator phenotypes. Polymorphisms in NAT2 are also associated with higher incidences of cancer and drug toxicity.
Molecular Weight 32 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Total IgG Protein A purified
Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NAT2 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling, Metabolism
Restrictions For Research Use only

Alternatives

Alternatives for antigen "N-Acetyltransferase 2 (Arylamine N-Acetyltransferase) (NAT2)", type "Antibodies"
Hosts Rabbit (7), Goat (3), Mouse (3)
Reactivities Human (10)
Applications Western Blotting (WB) (8), ELISA (Detection) (3), ELISA (2), Enzyme Immunoassay (EIA) (2), Immunohistochemistry (IHC) (2), Immunoprecipitation (IP) (1)