NAT2 antibody

Catalog No. ABIN630377

The Rabbit Polyclonal anti-NAT2 antibody is suitable to detect NAT2 in samples from Human. It has been validated for WB.

Quick Overview for NAT2 antibody (ABIN630377)

Target: NAT2 (N-Acetyltransferase 2 (Arylamine N-Acetyltransferase) (NAT2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NAT2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NAT2 Antibody

Purification: Purified

Immunogen: NAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIE

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NAT2 Blocking Peptide, (ABIN937133), is also available for use as a blocking control in assays to test for specificity of this NAT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NAT2

Target: NAT2 (N-Acetyltransferase 2 (Arylamine N-Acetyltransferase) (NAT2))

Alternative Name: NAT2

Background: NAT2 is a N-acetyltransferase 2 (arylamine N-acetyltransferase 2). This enzyme functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in its gene are reponsible for the N-acetylation polymorphism in which human populations segregate into rapid,intermediate, and slow acetylator phenotypes. Polymorphisms in NAT2 are also associated with higher incidences of cancer and drug toxicity.

Molecular Weight: 32 kDa (MW of target protein)