Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

ADAM Metallopeptidase Domain 30 (ADAM30) antibody

Antigen

ADAM Metallopeptidase Domain 30 (ADAM30)

Synonyms svph4, MGC132801, MGC132802, 4933424D07Rik
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN630427
Quantity 100 ug  (1 mg/ml)  (Variants)
Price 410.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name ADAM30
Immunogen ADAM30 antibody was raised using the N terminal of ADAM30 corresponding to a region with amino acids RLLLPRHLRVFSFTEHGELLEDHPYIPKDCNYMGSVKESLDSKATISTCM
Description ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM30 gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-terminal repeats.
Molecular Weight 66 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Total IgG Protein A purified
Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ADAM30 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Proteolysis / Ubiquitin, Metalloprotease, Extracellular Matrix
Restrictions For Research Use only

Alternatives

Alternatives for antigen "ADAM Metallopeptidase Domain 30 (ADAM30)", type "Antibodies"
Hosts Rabbit (6), Mouse (2)
Reactivities Human (7)
Applications Western Blotting (WB) (6), ELISA (4), Enzyme Immunoassay (EIA) (3), Flow Cytometry (FACS) (1), Immunohistochemistry (IHC) (1)
Epitopes C-Term (2)