UGT1A1 antibody (Middle Region)

Catalog No. ABIN630449

The Rabbit Polyclonal anti-UGT1A1 antibody is suitable to detect UGT1A1 in samples from Human. It has been validated for WB.

Quick Overview for UGT1A1 antibody (Middle Region) (ABIN630449)

Target: UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGT1A1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UGT1A1 Antibody

Binding Specificity: Middle Region

Specificity: UGT1 A1 antibody was raised against the middle region of µgT1 1

Purification: Purified

Immunogen: UGT1 A1 antibody was raised using the middle region of µgT1 1 corresponding to a region with amino acids ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGT1A1 Blocking Peptide, (ABIN936929), is also available for use as a blocking control in assays to test for specificity of this µgT1A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGT1A1

Target: UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1))

Alternative Name: UGT1A1

Background: UGT1A1 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha