TMED3 antibody (C-Term)

Catalog No. ABIN630470

The Rabbit Polyclonal anti-TMED3 antibody is suitable to detect TMED3 in samples from Human. It has been validated for WB.

Quick Overview for TMED3 antibody (C-Term) (ABIN630470)

Target: TMED3 (Transmembrane Emp24 Protein Transport Domain Containing 3 (TMED3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMED3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMED3 Antibody

Binding Specificity: C-Term

Specificity: TMED3 antibody was raised against the C terminal of TMED3

Purification: Purified

Immunogen: TMED3 antibody was raised using the C terminal of TMED3 corresponding to a region with amino acids DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMED3 Blocking Peptide, (ABIN937525), is also available for use as a blocking control in assays to test for specificity of this TMED3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMED3

Target: TMED3 (Transmembrane Emp24 Protein Transport Domain Containing 3 (TMED3))

Alternative Name: TMED3

Background: The function of this gene remains unknown.

Molecular Weight: 25 kDa (MW of target protein)