TMEM109 antibody (Middle Region)

Catalog No. ABIN630474

The Rabbit Polyclonal anti-TMEM109 antibody (ABIN630474) specifically detects TMEM109 in WB. The antibody is reactive with Human samples.

Quick Overview for TMEM109 antibody (Middle Region) (ABIN630474)

Target: TMEM109 (Transmembrane Protein 109 (TMEM109))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM109 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM109 Antibody

Binding Specificity: Middle Region

Specificity: TMEM109 antibody was raised against the middle region of TMEM109

Purification: Purified

Immunogen: TMEM109 antibody was raised using the middle region of TMEM109 corresponding to a region with amino acids GIAAQLLNALGLAGDYLAQGLKLSPGQVQTFLLWGAGALVVYWLLSLLLG

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM109 Blocking Peptide, (ABIN938708), is also available for use as a blocking control in assays to test for specificity of this TMEM109 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM109 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM109

Target: TMEM109 (Transmembrane Protein 109 (TMEM109))

Alternative Name: TMEM109

Background: The function of TMEM109 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 26 kDa (MW of target protein)