LCA5L antibody

Catalog No. ABIN630546

The Rabbit Polyclonal anti-LCA5L antibody (ABIN630546) specifically detects LCA5L in WB. The antibody is reactive with Human samples.

Quick Overview for LCA5L antibody (ABIN630546)

Target: LCA5L (Leber Congenital Amaurosis 5-Like (LCA5L))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LCA5L antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LCA5L Antibody

Purification: Affinity purified

Immunogen: C21 ORF13 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSEEPLQSKESHPLPPSQASTSHAFGDSKVTVVNSIKPSSPTEGKRKIII

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C21ORF13 Blocking Peptide, (ABIN938942), is also available for use as a blocking control in assays to test for specificity of this C21ORF13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LCA5L

Target: LCA5L (Leber Congenital Amaurosis 5-Like (LCA5L))

Alternative Name: C21ORF13

Background: The function of the C21orf13 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 76 kDa (MW of target protein)