DCAF4 antibody (Middle Region)

Catalog No. ABIN630556

This Rabbit Polyclonal antibody specifically detects DCAF4 in WB. It exhibits reactivity toward Human.

Quick Overview for DCAF4 antibody (Middle Region) (ABIN630556)

Target: DCAF4 (DDB1 and CUL4 Associated Factor 4 (DCAF4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DCAF4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DCAF4 Antibody

Binding Specificity: Middle Region

Specificity: WDR21 A antibody was raised against the middle region of WDR21

Purification: Affinity purified

Immunogen: WDR21 A antibody was raised using the middle region of WDR21 corresponding to a region with amino acids GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR21A Blocking Peptide, (ABIN938699), is also available for use as a blocking control in assays to test for specificity of this WDR21A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DCAF4

Target: DCAF4 (DDB1 and CUL4 Associated Factor 4 (DCAF4))

Alternative Name: WDR21A

Background: WDR21A is a WD repeat-containing protein. The function of WDR21A remains unknown.

Molecular Weight: 43 kDa (MW of target protein)