Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

phosphodiesterase 9A (PDE9A) antibody

Antigen

phosphodiesterase 9A (PDE9A)

Synonyms HSPDE9A2, PDE9A1, PDE9A, MGC116558, Pde9a, LOC799942
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Immunohistochemistry (IHC), Western Blotting (WB)
Catalog no. ABIN630634
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name PDE9A
Immunogen PDE9A antibody was raised using the N terminal of PDE9A corresponding to a region with amino acids SDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPET
Description PDE9A catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides.
Molecular Weight 61 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDE9A antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling, Enzymes, Metabolism
Restrictions For Research Use only