Lamin B1 (LMNB1) antibody
| Antigen |
|
| Synonyms |
LMN, ADLD, LMN2, LMNB, MGC111419, fc06g01, wu:fc06g01, MGC52550, Lamin-L(I), lmn, lmn2, lmnb, LMNB1, MGC165937, LOC100037680 |
| Clonality |
Polyclonal |
|
Host
|
|
|
Application
|
Western Blotting (WB) (27), Enzyme Immunoassay (EIA) (9), Immunofluorescence (IF) (8), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (8), Flow Cytometry (FACS) (6), Immunocytochemistry (ICC) (3), Immunoprecipitation (IP) (3), ELISA (2), ELISA (Detection) (2), Immunohistochemistry (Frozen Sections) (IHC (fro)) (2), Immunohistochemistry (IHC) (2)
|
| Catalog no. |
ABIN630637 |
| Quantity |
50 ug (1 mg/ml) (Variants) |
| Price |
478.33 $ Plus shipping costs $35.00
|
| Shipping to |
|
| Availability |
Ships within 5 to 7 Business Days |
|
Alternative name
|
Lamin B1
|
|
Immunogen
|
Lamin B1 antibody was raised using the middle region of LMNB1 corresponding to a region with amino acids EEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM
|
|
Description
|
LAMNB1 encodes for one of the two B type proteins of the nuclear lamina, B1. The Vertebrate lamins consist of two types, A and B. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression.
|
|
Molecular Weight
|
66 kDa (MW of target protein)
|
|
Concentration
|
1 mg/ml
|
|
Purification
|
Affinity purified
|
|
Buffer
|
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LMNB1 antibody in PBS
|
|
Storage
|
Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
|
|
Research Area
|
Signaling, Cytoskeleton, Apoptosis/Necrosis
|
|
Restrictions
|
For Research Use only
|
Alternatives for antigen "Lamin B1 (LMNB1)", type "Antibodies"
|
Hosts
|
Mouse (14), Rabbit (14)
|
|
Reactivities
|
Human (23), Mouse (Murine) (9), Rat (Rattus) (9), Cow (Bovine) (5), Dog (Canine) (5), Rabbit (5), Sheep (Ovine) (5), Chicken (1)
|
|
Applications
|
Western Blotting (WB) (27), Enzyme Immunoassay (EIA) (9), Immunofluorescence (IF) (8), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (8), Flow Cytometry (FACS) (6), Immunocytochemistry (ICC) (3), Immunoprecipitation (IP) (3), ELISA (2), ELISA (Detection) (2), Immunohistochemistry (Frozen Sections) (IHC (fro)) (2), Immunohistochemistry (IHC) (2)
|
|
Epitopes
|
C-Term (5)
|