Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Lamin B1 (LMNB1) antibody

Antigen

Lamin B1 (LMNB1)

Synonyms LMN, ADLD, LMN2, LMNB, MGC111419, fc06g01, wu:fc06g01, MGC52550, Lamin-L(I), lmn, lmn2, lmnb, LMNB1, MGC165937, LOC100037680
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN630637
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name Lamin B1
Immunogen Lamin B1 antibody was raised using the middle region of LMNB1 corresponding to a region with amino acids EEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM
Description LAMNB1 encodes for one of the two B type proteins of the nuclear lamina, B1. The Vertebrate lamins consist of two types, A and B. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression.
Molecular Weight 66 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LMNB1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling, Cytoskeleton, Apoptosis/Necrosis
Restrictions For Research Use only