MAP3K15 antibody (Middle Region)

Catalog No. ABIN630660

The Rabbit Polyclonal anti-MAP3K15 antibody (ABIN630660) specifically detects MAP3K15 in WB. The antibody is reactive with Human samples.

Quick Overview for MAP3K15 antibody (Middle Region) (ABIN630660)

Target: MAP3K15 (Mitogen-Activated Protein Kinase Kinase Kinase 15 (MAP3K15))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAP3K15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAP3K15 Antibody

Binding Specificity: Middle Region

Specificity: MAP3 K15 antibody was raised against the middle region of MAP3 15

Purification: Affinity purified

Immunogen: MAP3 K15 antibody was raised using the middle region of MAP3 15 corresponding to a region with amino acids TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAP3K15 Blocking Peptide, (ABIN5614652), is also available for use as a blocking control in assays to test for specificity of this MAP3K15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAP3K15

Target: MAP3K15 (Mitogen-Activated Protein Kinase Kinase Kinase 15 (MAP3K15))

Alternative Name: MAP3K15

Background: MAP3K15 is a component of a protein kinase signal transduction cascade.

Molecular Weight: 89 kDa (MW of target protein)