Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

phosphodiesterase 7B (PDE7B) antibody

Antigen

phosphodiesterase 7B (PDE7B)
Synonyms MGC88256, bA472E5.1, PDE7B, MGC151559, ba472e5.1
Clonality Polyclonal
Host
Alternatives

Rabbit
Application
Alternatives Western Blotting (WB)
Catalog no. ABIN630666
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information
Application Details Alternatives Secondary Antibodies Variants back to top

Alternative name PDE7B
Immunogen PDE7B antibody was raised using the middle region of PDE7B corresponding to a region with amino acids IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN
Description The 3',5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways.
Molecular Weight 52 kDa (MW of target protein)

Application Details
Alternatives Secondary Antibodies Variants back to top

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDE7B antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling, Enzymes, Metabolism
Restrictions For Research Use only

Alternatives
Application Details Secondary Antibodies Variants back to top

Alternatives for antigen "phosphodiesterase 7B (PDE7B)", type "Antibodies"
Hosts Rabbit (13), Mouse (2)
Reactivities Human (11), Mouse (Murine) (2), Rat (Rattus) (1)
Applications Western Blotting (WB) (9), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Immunoprecipitation (IP) (5), ELISA (3), ELISA (Detection) (1), Enzyme Immunoassay (EIA) (1)
Epitopes C-Term (2), N-Term (1)