ERCC4 antibody (Middle Region)

Catalog No. ABIN630690

The Rabbit Polyclonal anti-ERCC4 antibody (ABIN630690) specifically detects ERCC4 in WB. The antibody is reactive with Human samples.

Quick Overview for ERCC4 antibody (Middle Region) (ABIN630690)

Target: ERCC4 (Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 4 (ERCC4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERCC4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ERCC4 Antibody

Binding Specificity: Middle Region

Specificity: ERCC4 antibody was raised against the middle region of Ercc4

Purification: Affinity purified

Immunogen: ERCC4 antibody was raised using the middle region of Ercc4 corresponding to a region with amino acids FLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ERCC4 Blocking Peptide, (ABIN938360), is also available for use as a blocking control in assays to test for specificity of this ERCC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERCC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERCC4

Target: ERCC4 (Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 4 (ERCC4))

Alternative Name: ERCC4

Background: The protein encoded by this gene forms a complex with ERCC1 and is involved in the 5' incision made during nucleotide excision repair. This complex is a structure specific DNA repair endonuclease that interacts with EME1.

Molecular Weight: 101 kDa (MW of target protein)

Pathways: DNA Damage Repair