HIRIP3 antibody (Middle Region)

Catalog No. ABIN630758

The Rabbit Polyclonal anti-HIRIP3 antibody is suitable to detect HIRIP3 in samples from Human. It has been validated for WB.

Quick Overview for HIRIP3 antibody (Middle Region) (ABIN630758)

Target: HIRIP3 (HIRA Interacting Protein 3 (HIRIP3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HIRIP3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HIRIP3 Antibody

Binding Specificity: Middle Region

Specificity: HIRIP3 antibody was raised against the middle region of HIRIP3

Purification: Affinity purified

Immunogen: HIRIP3 antibody was raised using the middle region of HIRIP3 corresponding to a region with amino acids RTRSSSSSSDGSPEAKGGKAGSGRRGEDHPAVMRLKRYIRACGAHRNYKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HIRIP3 Blocking Peptide, (ABIN5614006), is also available for use as a blocking control in assays to test for specificity of this HIRIP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIRIP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HIRIP3

Target: HIRIP3 (HIRA Interacting Protein 3 (HIRIP3))

Alternative Name: HIRIP3

Background: The HIRA protein shares sequence similarity with Hir1p and Hir2p, the two corepressors of histone gene transcription characterized in the yeast, Saccharomyces cerevisiae.

Molecular Weight: 61 kDa (MW of target protein)