APPBP2 antibody

Catalog No. ABIN630772

This Rabbit Polyclonal antibody specifically detects APPBP2 in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for APPBP2 antibody (ABIN630772)

Target: APPBP2 (Amyloid beta Precursor Protein (Cytoplasmic Tail) Binding Protein 2 (APPBP2))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APPBP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-APPBP2 Antibody

Purification: Affinity purified

Immunogen: APPBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSDTLLDYGFYLLN

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

APPBP2 Blocking Peptide, (ABIN5612128), is also available for use as a blocking control in assays to test for specificity of this APPBP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APPBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APPBP2

Target: APPBP2 (Amyloid beta Precursor Protein (Cytoplasmic Tail) Binding Protein 2 (APPBP2))

Alternative Name: APPBP2

Background: APPBP2 interacts with microtubules and is functionally associated with beta-amyloid precursor protein transport and/or processing. The beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. APPBP2 has been found to be highly expressed in breast cancer.

Molecular Weight: 67 kDa (MW of target protein)