Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Lectin, Galactoside-Binding, Soluble, 8 (LGALS8) antibody

Antigen

Lectin, Galactoside-Binding, Soluble, 8 (LGALS8)

Synonyms Gal-8, PCTA1, PCTA-1, Po66-CBP, LGALS8, MGC133892
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN630814
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name LGALS8
Immunogen LGALS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD
Description LGALS8 is a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions.
Molecular Weight 39 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LGALS8 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Lectin, Galactoside-Binding, Soluble, 8 (LGALS8)", type "Antibodies"
Hosts Rabbit (22), Mouse (3)
Reactivities Human (25), Mouse (Murine) (20), Rat (Rattus) (19), Cow (Bovine) (2), Pig (Porcine) (1), Rabbit (1)
Applications Immunofluorescence (IF) (20), Flow Cytometry (FACS) (18), Western Blotting (WB) (8), ELISA (4), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunoprecipitation (IP) (2), ELISA (Detection) (1), Enzyme Immunoassay (EIA) (1), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1)