TLR6 antibody (Middle Region)

Catalog No. ABIN630842

The Rabbit Polyclonal anti-TLR6 antibody is suitable to detect TLR6 in samples from Human. It has been validated for WB and IHC.

Quick Overview for TLR6 antibody (Middle Region) (ABIN630842)

Target: TLR6 (Toll-Like Receptor 6 (TLR6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TLR6 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-TLR6 Antibody

Binding Specificity: Middle Region

Specificity: TLR6 antibody was raised against the middle region of TLR6

Purification: Affinity purified

Immunogen: TLR6 antibody was raised using the middle region of TLR6 corresponding to a region with amino acids KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TLR6 Blocking Peptide, (ABIN939659), is also available for use as a blocking control in assays to test for specificity of this TLR6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TLR6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TLR6

Target: TLR6 (Toll-Like Receptor 6 (TLR6))

Alternative Name: TLR6

Background: TLR6 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognise pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor functionally interacts with toll-like receptor 2 to mediate cellular response to bacterial lipoproteins.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: TLR Signaling, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades