PIWIL2 antibody

Catalog No. ABIN630850

This Rabbit Polyclonal antibody specifically detects PIWIL2 in WB. It exhibits reactivity toward Human.

Quick Overview for PIWIL2 antibody (ABIN630850)

Target: PIWIL2 (Piwi-Like 2 (PIWIL2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIWIL2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PIWIL2 Antibody

Purification: Affinity purified

Immunogen: PIWIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIWIL2 Blocking Peptide, (ABIN5615388), is also available for use as a blocking control in assays to test for specificity of this PIWIL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIWIL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIWIL2

Target: PIWIL2 (Piwi-Like 2 (PIWIL2))

Alternative Name: PIWIL2

Background: PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.

Molecular Weight: 110 kDa (MW of target protein)

Pathways: Stem Cell Maintenance