TGIF1 antibody (C-Term)

Catalog No. ABIN630855

The Rabbit Polyclonal anti-TGIF1 antibody (ABIN630855) specifically detects TGIF1 in WB. The antibody is reactive with Human samples.

Quick Overview for TGIF1 antibody (C-Term) (ABIN630855)

Target: TGIF1 (TGFB-Induced Factor Homeobox 1 (TGIF1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TGIF1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TGIF1 Antibody

Binding Specificity: C-Term

Specificity: TGIF1 antibody was raised against the C terminal of TGIF1

Purification: Affinity purified

Immunogen: TGIF1 antibody was raised using the C terminal of TGIF1 corresponding to a region with amino acids GQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TGIF1 Blocking Peptide, (ABIN938892), is also available for use as a blocking control in assays to test for specificity of this TGIF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGIF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TGIF1

Target: TGIF1 (TGFB-Induced Factor Homeobox 1 (TGIF1))

Alternative Name: TGIF1

Background: TGIF1 is a member of the three-amino acid loop extension (TALE) superclass of atypical homeodomains. TALE homeobox proteins are highly conserved transcription regulators. This particular homeodomain binds to a previously characterized retinoid X receptor responsive element from the cellular retinol-binding protein II promoter. In addition to its role in inhibiting 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element, the protein is an active transcriptional co-repressor of SMAD2 and may participate in the transmission of nuclear signals during development and in the adult. Mutations in this gene are associated with holoprosencephaly type 4, which is a structural anomaly of the brain.

Molecular Weight: 43 kDa (MW of target protein)

Pathways: Retinoic Acid Receptor Signaling Pathway, Chromatin Binding, Tube Formation