DNMT3B antibody

Catalog No. ABIN630856

This Rabbit Polyclonal antibody specifically detects DNMT3B in WB. It exhibits reactivity toward Human.

Quick Overview for DNMT3B antibody (ABIN630856)

Target: DNMT3B (DNA (Cytosine-5-)-Methyltransferase 3 beta (DNMT3B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNMT3B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DNMT3B Antibody

Purification: Affinity purified

Immunogen: DNMT3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNMT3B Blocking Peptide, (ABIN938993), is also available for use as a blocking control in assays to test for specificity of this DNMT3B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNMT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNMT3B

Target: DNMT3B (DNA (Cytosine-5-)-Methyltransferase 3 beta (DNMT3B))

Alternative Name: DNMT3B

Background: DNMT3B is required for genome wide de novo methylation and is essential for the establishment of DNA methylation patterns during development. DNA methylation is coordinated with methylation of histones. DNMT3B may preferentially methylate nucleosomal DNA within the nucleosome core region. DNMT3B may function as transcriptional co-repressor by associating with CBX4 and independently of DNA methylation. DNMT3B seems to be involved in gene silencing. In association with DNMT1 and via the recruitment of CTCFL/BORIS, DNMT3B is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.

Molecular Weight: 86 kDa (MW of target protein)