TNKS1BP1 antibody (Middle Region)

Catalog No. ABIN630864

The Rabbit Polyclonal anti-TNKS1BP1 antibody (ABIN630864) specifically detects TNKS1BP1 in WB. The antibody is reactive with Human samples.

Quick Overview for TNKS1BP1 antibody (Middle Region) (ABIN630864)

Target: TNKS1BP1 (Tankyrase 1 Binding Protein 1, 182kDa (TNKS1BP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TNKS1BP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TNKS1BP1 Antibody

Binding Specificity: Middle Region

Specificity: TNKS1 BP1 antibody was raised against the middle region of TNKS1 P1

Purification: Affinity purified

Immunogen: TNKS1 BP1 antibody was raised using the middle region of TNKS1 P1 corresponding to a region with amino acids DGEASQTEDVDGTWGSSAARWSDQGPAQTSRRPSQGPPARSPSQDFSFIE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TNKS1BP1 Blocking Peptide, (ABIN937331), is also available for use as a blocking control in assays to test for specificity of this TNKS1BP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNKS0 P1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TNKS1BP1

Target: TNKS1BP1 (Tankyrase 1 Binding Protein 1, 182kDa (TNKS1BP1))

Alternative Name: TNKS1BP1

Background: TNKS-1 mRNA in urine sediment from patients with bladder TCC correlated with tumor stage, and higher preoperative levels were associated with increased risk of early recurrence. Tankyrase-1 is required in the assembly of bipolar spindles and the spindle-pole protein NuMA as a substrate for covalent modification by tankyrase-1. Data also show that tankyrase 1 inhibition in human cancer cells enhances telomere shortening by a telomerase inhibitor and hastens cell death.

Molecular Weight: 190 kDa (MW of target protein)