TIMM44 antibody

Catalog No. ABIN630889

This Rabbit Polyclonal antibody specifically detects TIMM44 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for TIMM44 antibody (ABIN630889)

Target: TIMM44 (Translocase of Inner Mitochondrial Membrane 44 (TIMM44))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TIMM44 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TIMM44 Antibody

Purification: Affinity purified

Immunogen: TIMM44 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TIMM44 Blocking Peptide, (ABIN5616607), is also available for use as a blocking control in assays to test for specificity of this TIMM44 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIMM44 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TIMM44

Target: TIMM44 (Translocase of Inner Mitochondrial Membrane 44 (TIMM44))

Alternative Name: TIMM44

Background: TIMM44 is the essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner.

Molecular Weight: 51 kDa (MW of target protein)