UBE4B antibody

Catalog No. ABIN630903

The Rabbit Polyclonal anti-UBE4B antibody (ABIN630903) specifically detects UBE4B in WB. The antibody is reactive with Human samples.

Quick Overview for UBE4B antibody (ABIN630903)

Target: UBE4B (Ubiquitin Conjugation Factor E4 B (UBE4B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE4B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UBE4B Antibody

Purification: Affinity purified

Immunogen: UBE4 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE4B Blocking Peptide, (ABIN5616881), is also available for use as a blocking control in assays to test for specificity of this UBE4B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE4B

Target: UBE4B (Ubiquitin Conjugation Factor E4 B (UBE4B))

Alternative Name: UBE4B

Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4B is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. The gene that encodes the protein is also the strongest candidate in the neuroblastoma tumor suppressor genes.

Molecular Weight: 146 kDa (MW of target protein)