PEX5 antibody (Middle Region)

Catalog No. ABIN630928

This Rabbit Polyclonal antibody specifically detects PEX5 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for PEX5 antibody (Middle Region) (ABIN630928)

Target: PEX5 (Peroxisomal Biogenesis Factor 5 (PEX5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PEX5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PEX5 Antibody

Binding Specificity: Middle Region

Specificity: PEX5 antibody was raised against the middle region of PEX5

Purification: Affinity purified

Immunogen: PEX5 antibody was raised using the middle region of PEX5 corresponding to a region with amino acids LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PEX5 Blocking Peptide, (ABIN5615318), is also available for use as a blocking control in assays to test for specificity of this PEX5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PEX5

Target: PEX5 (Peroxisomal Biogenesis Factor 5 (PEX5))

Alternative Name: PEX5

Background: PEX5 binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups.

Molecular Weight: 70 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process