PEX5 antibody (N-Term)

Catalog No. ABIN630915

Product Details anti-PEX5 Antibody

Target: PEX5 (Peroxisomal Biogenesis Factor 5 (PEX5))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PEX5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PEX5 antibody was raised against the N terminal of PEX5

Purification: Affinity purified

Immunogen: PEX5 antibody was raised using the N terminal of PEX5 corresponding to a region with amino acids TATDRWYDEYHPEEDLQHTASDFVAKVDDPKLANSEFLKFVRQIGEGQVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PEX5 Blocking Peptide, catalog no. 33R-8985, is also available for use as a blocking control in assays to test for specificity of this PEX5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PEX5

Target: PEX5 (Peroxisomal Biogenesis Factor 5 (PEX5))

Alternative Name: PEX5 (PEX5 Products)

Synonyms: AW212715 antibody, ESTM1 antibody, PTS1R antibody, Pxr1 antibody, X83306 antibody, PTS1-BP antibody, PBD2A antibody, PBD2B antibody, PXR1 antibody, Peroxin-5 antibody, peroxisomal biogenesis factor 5 antibody, pex5 antibody, Pex5 antibody, PEX5 antibody

Background: PEX5 binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function.

Molecular Weight: 70 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process