Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Lysophospholipase I (LYPLA1) antibody

Antigen

Lysophospholipase I (LYPLA1)

Synonyms LPL1, APT-1, LYSOPLA
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN630946
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name LYPLA1
Immunogen LYPLA1 antibody was raised using the middle region of LYPLA1 corresponding to a region with amino acids SWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ
Description Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. LYPLA1 hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.
Molecular Weight 25 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LYPLA1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Lysophospholipase I (LYPLA1)", type "Antibodies"
Hosts Mouse (3), Rabbit (3)
Reactivities Human (6), Mouse (Murine) (1), Rat (Rattus) (1)
Applications Western Blotting (WB) (6), ELISA (Detection) (2), Enzyme Immunoassay (EIA) (2), ELISA (1), Flow Cytometry (FACS) (1), Immunocytochemistry (ICC) (1)