Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Tryptophanyl tRNA Synthetase 2, Mitochondrial (WARS2) antibody

Antigen

Tryptophanyl tRNA Synthetase 2, Mitochondrial (WARS2)

Synonyms TrpRS, zgc:110828, MGC127444
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN630987
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name WARS2
Immunogen WARS2 antibody was raised using the middle region of WARS2 corresponding to a region with amino acids TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG
Description Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. WARS2 is the mitochondrial tryptophanyl-tRNA synthetase.
Molecular Weight 24 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WARS2 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Tryptophanyl tRNA Synthetase 2, Mitochondrial (WARS2)", type "Antibodies"
Hosts Rabbit (4), Mouse (2)
Reactivities Human (6)
Applications Western Blotting (WB) (5), Enzyme Immunoassay (EIA) (3), ELISA (2), ELISA (Detection) (1), Immunohistochemistry (IHC) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1)
Epitopes C-Term (2)