Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

WBP2 N-terminal Like (WBP2NL) antibody

Antigen

WBP2 N-terminal Like (WBP2NL)

Synonyms PAWP, 4930521I23Rik, FLJ26145, MGC26816, WBP2NL, pawp
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN630989
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name WBP2NL
Immunogen WBP2NL antibody was raised using the N terminal of WBP2NL corresponding to a region with amino acids MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGT
Description WBP2NL may play a role in meotic resumption and pronuclear formation, mediated by a WW domain-signaling pathway during fertilization.
Molecular Weight 32 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WBP2NL antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "WBP2 N-terminal Like (WBP2NL)", type "Antibodies"
Hosts Goat (3), Mouse (2), Rabbit (1)
Reactivities Human (3)
Applications Western Blotting (WB) (3), ELISA (Detection) (2), ELISA (1), Enzyme Immunoassay (EIA) (1)