TXN2 antibody (Middle Region)

Catalog No. ABIN631006

This Rabbit Polyclonal antibody specifically detects TXN2 in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for TXN2 antibody (Middle Region) (ABIN631006)

Target: TXN2 (Thioredoxin 2 (TXN2))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TXN2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TXN2 Antibody

Binding Specificity: Middle Region

Specificity: Thioredoxin 2 antibody was raised against the middle region of TXN2

Purification: Affinity purified

Immunogen: Thioredoxin 2 antibody was raised using the middle region of TXN2 corresponding to a region with amino acids VDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Thioredoxin 2 Blocking Peptide, (ABIN5616586), is also available for use as a blocking control in assays to test for specificity of this Thioredoxin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TXN2

Target: TXN2 (Thioredoxin 2 (TXN2))

Alternative Name: Thioredoxin 2

Background: TXN2 is a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. TXN2 may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.

Molecular Weight: 12 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis