IDH2 antibody

Catalog No. ABIN631096

This Rabbit Polyclonal antibody specifically detects IDH2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for IDH2 antibody (ABIN631096)

Target: IDH2 (Isocitrate Dehydrogenase 2 (NADP+), Mitochondrial (IDH2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IDH2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IDH2 Antibody

Purification: Affinity purified

Immunogen: IDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IDH2 Blocking Peptide, (ABIN938690), is also available for use as a blocking control in assays to test for specificity of this IDH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IDH2

Target: IDH2 (Isocitrate Dehydrogenase 2 (NADP+), Mitochondrial (IDH2))

Alternative Name: IDH2

Background: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Warburg Effect