Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

3-hydroxyisobutyrate Dehydrogenase (HIBADH) antibody

Antigen

3-hydroxyisobutyrate Dehydrogenase (HIBADH)

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN631102
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name HIBADH
Immunogen HIBADH antibody was raised using the middle region of HIBADH corresponding to a region with amino acids WSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPIL
Description 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.
Molecular Weight 35 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HIBADH antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Metabolism, Amino Acids
Restrictions For Research Use only

Alternatives

Alternatives for antigen "3-hydroxyisobutyrate Dehydrogenase (HIBADH)", type "Antibodies"
Hosts Rabbit (4), Mouse (1)
Reactivities Human (4), Mouse (Murine) (1), Rat (Rattus) (1)
Applications Western Blotting (WB) (4), ELISA (3), ELISA (Detection) (1), Immunofluorescence (IF) (1), Immunohistochemistry (IHC) (1)