PIWIL1 antibody

Catalog No. ABIN631111

This Rabbit Polyclonal antibody specifically detects PIWIL1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for PIWIL1 antibody (ABIN631111)

Target: PIWIL1 (Piwi-Like 1 (PIWIL1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIWIL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PIWIL1 Antibody

Purification: Affinity purified

Immunogen: PIWIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIWIL1 Blocking Peptide, (ABIN5615387), is also available for use as a blocking control in assays to test for specificity of this PIWIL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIWIL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIWIL1

Target: PIWIL1 (Piwi-Like 1 (PIWIL1))

Alternative Name: PIWIL1

Background: PIWIL1 is a member of the PIWI subfamily of Argonaute proteins, evolutionarily conserved proteins containing both PAZ and Piwi motifs that play important roles in stem cell self-renewal, RNA silencing, and translational regulation in diverse organisms. PIWIL1 may play a role as an intrinsic regulator of the self-renewal capacity of germline and hematopoietic stem cells.

Molecular Weight: 98 kDa (MW of target protein)