HPD antibody (Middle Region)

Catalog No. ABIN631126

This Rabbit Polyclonal antibody specifically detects HPD in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for HPD antibody (Middle Region) (ABIN631126)

Target: HPD (4-Hydroxyphenylpyruvate Dioxygenase (HPD))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HPD antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HPD Antibody

Binding Specificity: Middle Region

Specificity: HPD antibody was raised against the middle region of HPD

Purification: Affinity purified

Immunogen: HPD antibody was raised using the middle region of HPD corresponding to a region with amino acids EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HPD Blocking Peptide, (ABIN937970), is also available for use as a blocking control in assays to test for specificity of this HPD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HPD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HPD

Target: HPD (4-Hydroxyphenylpyruvate Dioxygenase (HPD))

Alternative Name: HPD

Background: The protein encoded by this gene is an enzyme in the catabolic pathway of tyrosine. The encoded protein catalyzes the conversion of 4-hydroxyphenylpyruvate to homogentisate. Defects in this gene are a cause of tyrosinemia type 3 (TYRO3) and hawkinsinuria.

Molecular Weight: 45 kDa (MW of target protein)