Add to Basket
Order hotline:
 |
+1 404 474 4654 |
 |
+1 888 205 9894 (TF) |
Selenium Binding Protein 1 (SELENBP1) antibody
| Antigen | Selenium Binding Protein 1 (SELENBP1) |
| Synonyms | LPSB, SP56, hSBP, hSP56, FLJ13813, Lp56, Lpsb, SBP56, MGC18519, Selenbp2, MGC65844, zgc:65844, SELENBP1, hsbp, lpsb, sp56, sbp56, MGC82850, MGC129063, MGC115145, selenbp1-a, SBP, DKFZp469G1732 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Application |
Alternatives Western Blotting (WB)
|
| Catalog no. | ABIN631129 |
| Quantity | 50 ug (1 mg/ml) (Variants) |
| Price | 478.33 $ Plus shipping costs $35.00 |
| Shipping to |
|
| Availability | Ships within 5 to 7 Business Days |
Additional Information
| Alternative name | SELENBP1 |
| Immunogen | SELENBP1 antibody was raised using the N terminal of SELENBP1 corresponding to a region with amino acids MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVD |
| Description | SELENBP1 belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins. |
| Molecular Weight | 52 kDa (MW of target protein) |
Application Details
| Concentration | 1 mg/ml |
| Purification | Affinity purified |
| Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SELENBP1 antibody in PBS |
| Storage | Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles. |
| Restrictions | For Research Use only |
Alternatives
Alternatives for antigen "Selenium Binding Protein 1 (SELENBP1)", type "Antibodies"
| Hosts | Rabbit (2) |
| Reactivities | Human (1) |
| Applications | Western Blotting (WB) (2), ELISA (1) |
