Diazepam Binding Inhibitor antibody

Catalog No. ABIN631130

The Rabbit Polyclonal anti-Diazepam Binding Inhibitor antibody is suitable to detect Diazepam Binding Inhibitor in samples from Human. It has been validated for WB.

Quick Overview for Diazepam Binding Inhibitor antibody (ABIN631130)

Target: Diazepam Binding Inhibitor (DBI)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Diazepam Binding Inhibitor antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Diazepam Binding Inhibitor Antibody

Purification: Affinity purified

Immunogen: DBI antibody was raised using a synthetic peptide corresponding to a region with amino acids MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DBI Blocking Peptide, (ABIN5613127), is also available for use as a blocking control in assays to test for specificity of this DBI antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DBI antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Diazepam Binding Inhibitor

Target: Diazepam Binding Inhibitor (DBI)

Alternative Name: DBI

Background: DBI is diazepam binding inhibitor. The protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. DBI is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis.

Molecular Weight: 10 kDa (MW of target protein)