TGS1 antibody

Catalog No. ABIN631136

The Rabbit Polyclonal anti-TGS1 antibody is suitable to detect TGS1 in samples from Human and Mouse. It has been validated for WB.

Quick Overview for TGS1 antibody (ABIN631136)

Target: TGS1 (Trimethylguanosine Synthase 1 (TGS1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TGS1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TGS1 Antibody

Purification: Affinity purified

Immunogen: TGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TGS1 Blocking Peptide, (ABIN939296), is also available for use as a blocking control in assays to test for specificity of this TGS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TGS1

Target: TGS1 (Trimethylguanosine Synthase 1 (TGS1))

Alternative Name: TGS1

Background: TGS1 catalyzes the methylation step(s) for the conversion of the 7-monomethylguanosine (m7G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. TGS1 plays a role in transcriptional regulation.

Molecular Weight: 96 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, Regulation of Lipid Metabolism by PPARalpha, Ribonucleoprotein Complex Subunit Organization