FECH antibody

Catalog No. ABIN631196

The Rabbit Polyclonal anti-FECH antibody is suitable to detect FECH in samples from Human. It has been validated for WB.

Quick Overview for FECH antibody (ABIN631196)

Target: FECH (Ferrochelatase (FECH))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FECH antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FECH Antibody

Purification: Affinity purified

Immunogen: FECH antibody was raised using a synthetic peptide corresponding to a region with amino acids KRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FECH Blocking Peptide, (ABIN940022), is also available for use as a blocking control in assays to test for specificity of this FECH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FECH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FECH

Target: FECH (Ferrochelatase (FECH))

Alternative Name: FECH

Background: FECH is localized to the mitochondrion, where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Mutations in this gene are associated with erythropoietic protoporphyria. Two transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis