Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ubiquitin Associated and SH3 Domain Containing, A (UBASH3A) antibody

Antigen

Ubiquitin Associated and SH3 Domain Containing, A (UBASH3A)

Synonyms TULA, CLIP4, STS-2, Sts-2, C330001M22, 5830413C03Rik, UBASH3A
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN631208
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name UBASH3A
Immunogen UBASH3A antibody was raised using the middle region of UBASH3A corresponding to a region with amino acids PCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFASPA
Description UBASH3A interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. It also promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface.
Molecular Weight 74 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBASH3A antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Ubiquitin Associated and SH3 Domain Containing, A (UBASH3A)", type "Antibodies"
Hosts Goat (5), Mouse (4), Rabbit (2)
Reactivities Human (8), Dog (Canine) (1)
Applications Enzyme Immunoassay (EIA) (5), Western Blotting (WB) (5), ELISA (2), ELISA (Detection) (2), Immunofluorescence (IF) (1), Immunohistochemistry (IHC) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1)
Epitopes internal (2), N-Term (1)