Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

ACP6 antibody

Antigen

ACP6

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN631247
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Immunogen ACP6 antibody was raised using the N terminal of ACP6 corresponding to a region with amino acids EADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPLEEQVEWNPQLLEVPP
Description ACP6 could hydrolyze lysophosphatidic acid to monoacylglycerol. It was originally reported to be located in the mitochondrion, but the evidence seems to be weak and contradictory with the presence of a cleaved signal sequence.
Molecular Weight 49 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACP6 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling, Metabolism, Amino Acids
Restrictions For Research Use only

Alternatives

Alternatives for antigen "ACP6", type "Antibodies"
Hosts Rabbit (3)
Reactivities Human (2)
Applications Western Blotting (WB) (3), ELISA (2)