Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

WAS Protein Family, Member 3 (WASF3) antibody

Antigen

WAS Protein Family, Member 3 (WASF3)

Synonyms SCAR3, WAVE3, Brush-1, KIAA0900
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN631248
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name WASF3
Immunogen WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK
Description WASF3 is a member of the Wiskott-Aldrich syndrome protein family. It is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function.
Molecular Weight 55 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WASF3 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "WAS Protein Family, Member 3 (WASF3)", type "Antibodies"
Hosts Rabbit (26), Mouse (2)
Reactivities Human (27), Mouse (Murine) (19), Rat (Rattus) (17), Cow (Bovine) (16), Pig (Porcine) (15), Rabbit (15), Chicken (1), Dog (Canine) (1)
Applications Flow Cytometry (FACS) (18), Immunofluorescence (IF) (18), ELISA (7), Western Blotting (WB) (7), ELISA (Detection) (3), Immunoprecipitation (IP) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1)