AHCY antibody (N-Term)

Catalog No. ABIN631294

This Rabbit Polyclonal antibody specifically detects AHCY in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for AHCY antibody (N-Term) (ABIN631294)

Target: AHCY (Adenosylhomocysteinase (AHCY))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AHCY antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AHCY Antibody

Binding Specificity: N-Term

Specificity: AHCY antibody was raised against the N terminal of AHCY

Purification: Affinity purified

Immunogen: AHCY antibody was raised using the N terminal of AHCY corresponding to a region with amino acids SDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AHCY Blocking Peptide, (ABIN5611977), is also available for use as a blocking control in assays to test for specificity of this AHCY antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHCY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AHCY

Target: AHCY (Adenosylhomocysteinase (AHCY))

Alternative Name: AHCY

Background: S-adenosylhomocysteine hydrolase catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia.

Molecular Weight: 48 kDa (MW of target protein)