METTL2B antibody (N-Term)

Catalog No. ABIN631333

This Rabbit Polyclonal antibody specifically detects METTL2B in WB. It exhibits reactivity toward Human.

Quick Overview for METTL2B antibody (N-Term) (ABIN631333)

Target: METTL2B (Methyltransferase Like 2B (METTL2B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This METTL2B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-METTL2B Antibody

Binding Specificity: N-Term

Specificity: METTL2 B antibody was raised against the N terminal of METTL2

Purification: Affinity purified

Immunogen: METTL2 B antibody was raised using the N terminal of METTL2 corresponding to a region with amino acids AGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

METTL2B Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this METTL2B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for METTL2B

Target: METTL2B (Methyltransferase Like 2B (METTL2B))

Alternative Name: METTL2B

Background: METTL2B is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described, however, not all variants have been fully characterized.

Molecular Weight: 43 kDa (MW of target protein)