FBXW11 antibody (N-Term)

Catalog No. ABIN631368

The Rabbit Polyclonal anti-FBXW11 antibody (ABIN631368) specifically detects FBXW11 in WB. The antibody is reactive with Human and Mouse samples.

Quick Overview for FBXW11 antibody (N-Term) (ABIN631368)

Target: FBXW11 (F-Box and WD Repeat Domain Containing 11 (FBXW11))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXW11 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FBXW11 Antibody

Binding Specificity: N-Term

Specificity: FBXW11 antibody was raised against the N terminal of FBXW11

Purification: Affinity purified

Immunogen: FBXW11 antibody was raised using the N terminal of FBXW11 corresponding to a region with amino acids CLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXW11 Blocking Peptide, (ABIN937130), is also available for use as a blocking control in assays to test for specificity of this FBXW11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXW11

Target: FBXW11 (F-Box and WD Repeat Domain Containing 11 (FBXW11))

Alternative Name: FBXW11

Background: FBXW11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbws class and, in addition to an F-box, contains multiple WD40 repeats.

Molecular Weight: 62 kDa (MW of target protein)