KRT16 antibody

Catalog No. ABIN631442

The Rabbit Polyclonal anti-KRT16 antibody is suitable to detect KRT16 in samples from Human. It has been validated for WB.

Quick Overview for KRT16 antibody (ABIN631442)

Target: KRT16 (Keratin 16 (KRT16))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KRT16 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KRT16 Antibody

Purification: Affinity purified

Immunogen: Cytokeratin 16 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cytokeratin 16 Blocking Peptide, (ABIN939275), is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KRT16

Target: KRT16 (Keratin 16 (KRT16))

Alternative Name: Cytokeratin 16

Background: KRT16 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles.

Molecular Weight: 51 kDa (MW of target protein)