MTHFD1 antibody

Catalog No. ABIN631466

The Rabbit Polyclonal anti-MTHFD1 antibody is suitable to detect MTHFD1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for MTHFD1 antibody (ABIN631466)

Target: MTHFD1 (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 1, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase (MTHFD1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTHFD1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MTHFD1 Antibody

Purification: Affinity purified

Immunogen: MTHFD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MTHFD1 Blocking Peptide, (ABIN937137), is also available for use as a blocking control in assays to test for specificity of this MTHFD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTHFD1

Target: MTHFD1 (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 1, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase (MTHFD1))

Alternative Name: MTHFD1

Background: MTHFD1 possesses three distinct enzymatic activities, 5,10-methylenetetrahydrofolate dehydrogenase, 5,10-methenyltetrahydrofolate cyclohydrolase and 10-formyltetrahydrofolate synthetase. Each of these activities catalyzes one of three sequential reactions in the interconversion of 1-carbon derivatives of tetrahydrofolate, which are substrates for methionine, thymidylate, and de novo purine syntheses. The trifunctional enzymatic activities are conferred by two major domains, an aminoterminal portion containing the dehydrogenase and cyclohydrolase activities and a larger synthetase domain.

Molecular Weight: 101 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process