MAP1LC3A antibody (N-Term)

Catalog No. ABIN631468

This Rabbit Polyclonal antibody specifically detects MAP1LC3A in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for MAP1LC3A antibody (N-Term) (ABIN631468)

Target: MAP1LC3A (Microtubule-Associated Protein 1 Light Chain 3 alpha (MAP1LC3A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAP1LC3A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAP1LC3A Antibody

Binding Specificity: N-Term

Specificity: MAP1 LC1 antibody was raised against the N terminal of MAP1 C1

Purification: Affinity purified

Immunogen: MAP1 LC1 antibody was raised using the N terminal of MAP1 C1 corresponding to a region with amino acids MKMRFFSSPCGKAAVDPADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAP1LC3A Blocking Peptide, (ABIN5614647), is also available for use as a blocking control in assays to test for specificity of this MAP1LC3A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 C0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAP1LC3A

Target: MAP1LC3A (Microtubule-Associated Protein 1 Light Chain 3 alpha (MAP1LC3A))

Alternative Name: MAP1LC3A

Background: MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. MAP1LC3A is one of the light chain subunits and can associate with either MAP1A or MAP1B.MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits.

Molecular Weight: 14 kDa (MW of target protein)

Pathways: Autophagy